PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J02816.1.p
Common NameEUGRSUZ_J02816, LOC104424126
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 299aa    MW: 33447.4 Da    PI: 4.7463
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J02816.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.19.6e-191461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+W+ +Ede+l+++vk +G g W+++a+  g++R++k+c+ rw++yl
  Eucgr.J02816.1.p 14 KGAWSSQEDEILINYVKIHGEGKWRKVAQNAGLNRCAKSCRFRWLNYL 61
                      79********************************************97 PP

2Myb_DNA-binding507e-1667111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg  T++E++l+++++++lG++ W++Ia +++ gRt++++k++w++ 
  Eucgr.J02816.1.p  67 RGDITKDEEDLIIRLHQLLGNR-WALIAGRLP-GRTDNEIKNYWNTN 111
                       6778******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-24564IPR009057Homeodomain-like
PROSITE profilePS5129426.525965IPR017930Myb domain
SuperFamilySSF466892.28E-3011108IPR009057Homeodomain-like
SMARTSM007175.7E-161363IPR001005SANT/Myb domain
PfamPF002494.0E-171461IPR001005SANT/Myb domain
CDDcd001672.70E-121661No hitNo description
Gene3DG3DSA:1.10.10.602.6E-2365115IPR009057Homeodomain-like
PROSITE profilePS5129418.17366116IPR017930Myb domain
SMARTSM007171.5E-1566114IPR001005SANT/Myb domain
PfamPF002491.2E-1467112IPR001005SANT/Myb domain
CDDcd001675.52E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MVRSPCCAKV GINKGAWSSQ EDEILINYVK IHGEGKWRKV AQNAGLNRCA KSCRFRWLNY  60
LRPGIKRGDI TKDEEDLIIR LHQLLGNRWA LIAGRLPGRT DNEIKNYWNT NLAKNFGSFS  120
SRSSCKMKFD QDLGVQEYQD HITMNHSPVD PNEPLGISGI PILKEEEKPL LANESTSFIK  180
NGSNDHGQDM FSSLLVGDDD DLSFLMSIDT DFGEGVTDFD LQLFRDDQAA VRQENDDLGI  240
IVSRVDSNDG ISSSSLHSSG HDQVKVERGL MSGQIPSLDL ELKKLASFLD LEDDWTEL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J02816.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010034805.10.0PREDICTED: transcription factor WER-like
TrEMBLA0A059AHP00.0A0A059AHP0_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3504822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.11e-56myb domain protein 5